TCEAL3 (NM_032926) Human Mass Spec Standard
CAT#: PH318119
TCEAL3 MS Standard C13 and N15-labeled recombinant protein (NP_116315)
View other "TCEAL3" proteins (7)
| Need it in bulk or customized? Get a free quote | 
CNY 19520.00
Specifications
| Product Data | |
| Description | TCEAL3 MS Standard C13 and N15-labeled recombinant protein (NP_116315) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC218119 | 
| Predicted MW | 22.5 kDa | 
| Protein Sequence | >RC218119 protein sequence Red=Cloning site Green=Tags(s) MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQLEDEGSQEKQG RSEGEGKPQGEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMM RECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_116315 | 
| RefSeq Size | 1142 | 
| RefSeq ORF | 600 | 
| Synonyms | WEX8 | 
| Locus ID | 85012 | 
| Cytogenetics | Xq22.2 | 
| Summary | This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC409871 | TCEAL3 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC423552 | TCEAL3 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY409871 | Transient overexpression lysate of transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 2 | CNY 3080.00 | |
| LY423552 | Transient overexpression lysate of transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1 | CNY 3080.00 | |
| PH303524 | TCEAL3 MS Standard C13 and N15-labeled recombinant protein (NP_001006934) | CNY 19520.00 | |
| TP303524 | Recombinant protein of human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP318119 | Recombinant protein of human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 2, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 

 
                        


 
        