SYTL2 (NM_032379) Human Mass Spec Standard
CAT#: PH318076
SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_115755)
View other "SYTL2" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_115755) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218076 |
| Predicted MW | 42.6 kDa |
| Protein Sequence |
>RC218076 representing NM_032379
Red=Cloning site Green=Tags(s) MSKSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEV KGNIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNE ILRYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAEN RGEMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKT TNPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWE KMVNSPNTWIEATLPLRMLLIAKISK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115755 |
| RefSeq Size | 2407 |
| RefSeq ORF | 1128 |
| Synonyms | CHR11SYT; EXO4; SGA72M; SLP2; SLP2A |
| Locus ID | 54843 |
| Cytogenetics | 11q14.1 |
| Summary | The protein encoded by this gene is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. The SLP homology domain (SHD) of this protein has been shown to specifically bind the GTP-bound form of Ras-related protein Rab-27A (RAB27A). This protein plays a role in RAB27A-dependent vesicle trafficking and controls melanosome distribution in the cell periphery. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jun 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403206 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC404177 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404178 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410172 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403206 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant a |
CNY 4840.00 |
|
| LY404177 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant e |
CNY 3080.00 |
|
| LY404178 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant f |
CNY 3080.00 |
|
| LY410172 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant b |
CNY 3080.00 |
|
| PH317584 | SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_116561) |
CNY 19520.00 |
|
| PH317701 | SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_996812) |
CNY 19520.00 |
|
| TP317584 | Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant a, 20 µg |
CNY 2900.00 |
|
| TP317701 | Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant e, 20 µg |
CNY 2900.00 |
|
| TP318076 | Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant b, 20 µg |
CNY 2900.00 |
