CLIC1 (NM_001288) Human Mass Spec Standard
CAT#: PH318042
CLIC1 MS Standard C13 and N15-labeled recombinant protein (NP_001279)
View other "CLIC1" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | CLIC1 MS Standard C13 and N15-labeled recombinant protein (NP_001279) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC218042 | 
| Predicted MW | 26.7 kDa | 
| Protein Sequence | 
                 >RC218042 representing NM_001288 
Red=Cloning site Green=Tags(s) MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYG TEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVL DNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYL SNAYAREEFASTCPDDEEIELAYEQVAKALK myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001279 | 
| RefSeq Size | 1265 | 
| RefSeq ORF | 723 | 
| Synonyms | CL1C1; CLCNL1; G6; NCC27 | 
| Locus ID | 1192 | 
| Cytogenetics | 6p21.33 | 
| Summary | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome, Ion Channels: Other | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400515 | CLIC1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400515 | Transient overexpression lysate of chloride intracellular channel 1 (CLIC1) | 
                                                     CNY 3080.00  | 
                                            |
| TP318042 | Recombinant protein of human chloride intracellular channel 1 (CLIC1), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP720956 | Purified recombinant protein of Human chloride intracellular channel 1 (CLIC1) | 
                                                     CNY 1800.00  | 
                                            
