ODAPH (NM_178497) Human Mass Spec Standard
CAT#: PH318037
C4orf26 MS Standard C13 and N15-labeled recombinant protein (NP_848592)
View other "ODAPH" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C4orf26 MS Standard C13 and N15-labeled recombinant protein (NP_848592) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218037 |
Predicted MW | 15.6 kDa |
Protein Sequence |
>RC218037 protein sequence
Red=Cloning site Green=Tags(s) MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRC PFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_848592 |
RefSeq Size | 1882 |
RefSeq ORF | 390 |
Synonyms | AI2A4; C4orf26 |
Locus ID | 152816 |
Cytogenetics | 4q21.1 |
Summary | Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene is thought to encode an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis. Mutations in this gene are associated with recessive hypomineralized amelogenesis imperfecta. [provided by RefSeq, Oct 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405890 | C4orf26 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405890 | Transient overexpression lysate of chromosome 4 open reading frame 26 (C4orf26) |
CNY 3080.00 |
|
TP318037 | Recombinant protein of human chromosome 4 open reading frame 26 (C4orf26), 20 µg |
CNY 2900.00 |