TPM1 (NM_001018005) Human Mass Spec Standard
CAT#: PH318007
TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018005)
View other "TPM1" proteins (23)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 14250.00
Specifications
| Product Data | |
| Description | TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018005) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC218007 | 
| Predicted MW | 32.5 kDa | 
| Protein Sequence | 
                 >RC218007 representing NM_001018005 
Red=Cloning site Green=Tags(s) MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEK LELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEK MEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQ AEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALND MTSI myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001018005 | 
| RefSeq Size | 1246 | 
| RefSeq ORF | 852 | 
| Synonyms | C15orf13; CMD1Y; CMH3; HEL-S-265; HTM-alpha; LVNC9; TMSA | 
| Locus ID | 7168 | 
| Cytogenetics | 15q22.2 | 
| Summary | This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC422687 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC422688 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC422689 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC422690 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC422696 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC424765 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY422687 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 3 | 
                                                     CNY 3080.00  | 
                                            |
| LY422688 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY422689 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 4 | 
                                                     CNY 3080.00  | 
                                            |
| LY422690 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| LY422696 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 7 | 
                                                     CNY 3080.00  | 
                                            |
| LY424765 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 5 | 
                                                     CNY 3080.00  | 
                                            |
| PH301262 | TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_000357) | 
                                                     CNY 19520.00  | 
                                            |
| PH318995 | TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018020) | 
                                                     CNY 14250.00  | 
                                            |
| PH319543 | TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018004) | 
                                                     CNY 14250.00  | 
                                            |
| PH319606 | TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018006) | 
                                                     CNY 14250.00  | 
                                            |
| PH319652 | TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018007) | 
                                                     CNY 14250.00  | 
                                            |
| TP301262 | Recombinant protein of human tropomyosin 1 (alpha) (TPM1), transcript variant 5, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP318007 | Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP318995 | Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 7, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP319543 | Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 3, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP319606 | Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 4, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP319652 | Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 2, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
