MIA40 (CHCHD4) (NM_001098502) Human Mass Spec Standard
CAT#: PH317831
CHCHD4 MS Standard C13 and N15-labeled recombinant protein (NP_001091972)
View other "MIA40" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CHCHD4 MS Standard C13 and N15-labeled recombinant protein (NP_001091972) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217831 |
| Predicted MW | 15.8 kDa |
| Protein Sequence |
>RC217831 representing NM_001098502
Red=Cloning site Green=Tags(s) MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKS AFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEG SS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001091972 |
| RefSeq Size | 1476 |
| RefSeq ORF | 426 |
| Synonyms | MIA40; TIMM40 |
| Locus ID | 131474 |
| Cytogenetics | 3p25.1 |
| Summary | CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420602 | CHCHD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420602 | Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| TP317831 | Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
