HERPUD1 (NM_001010990) Human Mass Spec Standard
CAT#: PH317811
HERPUD1 MS Standard C13 and N15-labeled recombinant protein (NP_001010990)
View other "HERPUD1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | HERPUD1 MS Standard C13 and N15-labeled recombinant protein (NP_001010990) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217811 |
| Predicted MW | 40.7 kDa |
| Protein Sequence |
>RC217811 representing NM_001010990
Red=Cloning site Green=Tags(s) MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLR DLLPKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPY GWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVV VNPGANQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVMYLHHV GWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHLPPDRDVLDGEQTSPSFMSTAWLVFK TFFASLLPEGPPAIAN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001010990 |
| RefSeq Size | 2123 |
| RefSeq ORF | 1098 |
| Synonyms | HERP; Mif1; SUP |
| Locus ID | 9709 |
| Cytogenetics | 16q13 |
| Summary | The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response. This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involved in polypeptide folding, known as the unfolded protein response (UPR), and the destruction of misfolded proteins by the ER-associated protein degradation (ERAD) system. This gene may play a role in both UPR and ERAD. Its expression is induced by UPR and it has an ER stress response element in its promoter region while the encoded protein has an N-terminal ubiquitin-like domain which may interact with the ERAD system. This protein has been shown to interact with presenilin proteins and to increase the level of amyloid-beta protein following its overexpression. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms. The full-length nature of all transcript variants has not been determined. [provided by RefSeq, Jan 2013] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402364 | HERPUD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423260 | HERPUD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423261 | HERPUD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402364 | Transient overexpression lysate of homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 1 |
CNY 3080.00 |
|
| LY423260 | Transient overexpression lysate of homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 2 |
CNY 3080.00 |
|
| LY423261 | Transient overexpression lysate of homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 3 |
CNY 3080.00 |
|
| PH300693 | HERPUD1 MS Standard C13 and N15-labeled recombinant protein (NP_001010989) |
CNY 19520.00 |
|
| PH311835 | HERPUD1 MS Standard C13 and N15-labeled recombinant protein (NP_055500) |
CNY 14250.00 |
|
| TP300693 | Recombinant protein of human homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP311835 | Recombinant protein of human homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317811 | Purified recombinant protein of Homo sapiens homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 3, 20 µg |
CNY 2900.00 |
其它HERPUD1产品
