H2BC4 (NM_003526) Human Mass Spec Standard
CAT#: PH317796
HIST1H2BC MS Standard C13 and N15-labeled recombinant protein (NP_003517)
View other "H2BC4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HIST1H2BC MS Standard C13 and N15-labeled recombinant protein (NP_003517) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217796 |
| Predicted MW | 13.7 kDa |
| Protein Sequence |
>RC217796 representing NM_003526
Red=Cloning site Green=Tags(s) MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003517 |
| RefSeq Size | 438 |
| RefSeq ORF | 378 |
| Synonyms | dJ221C16.3; H2B.1; H2B/l; H2BC6; H2BC7; H2BC8; H2BC10; H2BFL; HIST1H2BC |
| Locus ID | 8347 |
| Cytogenetics | 6p22.2 |
| Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. The protein has antibacterial and antifungal antimicrobial activity. The main transcript variant of this gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. This transcript variant lacks a polyA tail but instead contains a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq, Apr 2020] |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | Systemic lupus erythematosus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418614 | HIST1H2BC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418614 | Transient overexpression lysate of histone cluster 1, H2bc (HIST1H2BC) |
CNY 3080.00 |
|
| TP317796 | Recombinant protein of human histone cluster 1, H2bc (HIST1H2BC), 20 µg |
CNY 2900.00 |
