LIGHT (TNFSF14) (NM_003807) Human Mass Spec Standard
CAT#: PH317759
TNFSF14 MS Standard C13 and N15-labeled recombinant protein (NP_003798)
View other "LIGHT" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TNFSF14 MS Standard C13 and N15-labeled recombinant protein (NP_003798) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217759 |
| Predicted MW | 26.35 kDa |
| Protein Sequence |
>RC217759 representing NM_003807
Red=Cloning site Green=Tags(s) MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVT RLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGY YYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLE AGEKVVVRVLDERLVRLRDGTRSYFGAFMV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003798 |
| RefSeq Size | 1491 |
| RefSeq ORF | 720 |
| Synonyms | CD258; HVEML; LIGHT; LTg |
| Locus ID | 8740 |
| Cytogenetics | 19p13.3 |
| Summary | The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418409 | TNFSF14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418409 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1 |
CNY 3080.00 |
|
| TP317759 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, 20 µg |
CNY 2900.00 |
