OST beta (SLC51B) (NM_178859) Human Mass Spec Standard
CAT#: PH317638
OSTBETA MS Standard C13 and N15-labeled recombinant protein (NP_849190)
View other "OST beta" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | OSTBETA MS Standard C13 and N15-labeled recombinant protein (NP_849190) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217638 |
Predicted MW | 14.3 kDa |
Protein Sequence |
>RC217638 protein sequence
Red=Cloning site Green=Tags(s) MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPP EKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_849190 |
RefSeq Size | 940 |
RefSeq ORF | 384 |
Synonyms | OSTB; OSTBETA |
Locus ID | 123264 |
Cytogenetics | 15q22.31 |
Summary | Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids. Modulates SLC51A glycosylation, membrane trafficking and stability activities.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405823 | SLC51B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405823 | Transient overexpression lysate of organic solute transporter beta (OSTBETA) |
CNY 3080.00 |
|
TP317638 | Recombinant protein of human organic solute transporter beta (OSTbeta), 20 µg |
CNY 2900.00 |
其它OST beta产品