WIPF1 (NM_003387) Human Mass Spec Standard
CAT＃: PH317601
WIPF1 MS Standard C13 and N15-labeled recombinant protein (NP_003378)
View other "WIPF1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | WIPF1 MS Standard C13 and N15-labeled recombinant protein (NP_003378) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217601 |
| Predicted MW | 51.1 kDa |
| Protein Sequence |
>RC217601 representing NM_003387
Red=Cloning site Green=Tags(s) MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGAGGG GGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPLLPPGGRSTSAKP FSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSLHNRGSPPVPGGP RQPSPGPTPPPFPGNRGTALGGGSIRQSPLSSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHRE AVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPS PGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNR RERGAPPLPPIPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003378 |
| RefSeq Size | 4605 |
| RefSeq ORF | 1509 |
| Synonyms | PRPL-2; WAS2; WASPIP; WIP |
| Locus ID | 7456 |
| Cytogenetics | 2q31.1 |
| Summary | This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401163 | WIPF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421397 | WIPF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401163 | Transient overexpression lysate of WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 1 |
CNY 4840.00 |
|
| LY421397 | Transient overexpression lysate of WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 2 |
CNY 4840.00 |
|
| PH312019 | WIPF1 MS Standard C13 and N15-labeled recombinant protein (NP_001070737) |
CNY 19520.00 |
|
| TP312019 | Recombinant protein of human WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP317601 | Recombinant protein of human WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 1, 20 µg |
CNY 2900.00 |
