FAHD1 (NM_031208) Human Mass Spec Standard
CAT#: PH317597
FAHD1 MS Standard C13 and N15-labeled recombinant protein (NP_112485)
View other "FAHD1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FAHD1 MS Standard C13 and N15-labeled recombinant protein (NP_112485) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217597 |
Predicted MW | 24.7 kDa |
Protein Sequence |
>RC217597 representing NM_031208
Red=Cloning site Green=Tags(s) MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHH ELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKI PDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIH GLVSMTFKVEKPEY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112485 |
RefSeq Size | 1706 |
RefSeq ORF | 672 |
Synonyms | C16orf36; YISKL |
Locus ID | 81889 |
Cytogenetics | 16p13.3 |
Summary | Probable mitochondrial acylpyruvase which is able to hydrolyze acetylpyruvate and fumarylpyruvate in vitro (PubMed:15551868, PubMed:21878618). Also has oxaloacetate decarboxylase activity (PubMed:25575590).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410588 | FAHD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422654 | FAHD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410588 | Transient overexpression lysate of fumarylacetoacetate hydrolase domain containing 1 (FAHD1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
LY422654 | Transient overexpression lysate of fumarylacetoacetate hydrolase domain containing 1 (FAHD1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
TP317597 | Recombinant protein of human fumarylacetoacetate hydrolase domain containing 1 (FAHD1), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2900.00 |