FOXP3 (NM_014009) Human Mass Spec Standard
CAT#: PH317580
FOXP3 MS Standard C13 and N15-labeled recombinant protein (NP_054728)
View other "FOXP3" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 4840.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | FOXP3 MS Standard C13 and N15-labeled recombinant protein (NP_054728) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217580 |
| Predicted MW | 47.1 kDa |
| Protein Sequence |
>RC217580 representing NM_014009
Red=Cloning site Green=Tags(s) MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQ LPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGV FSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEE PEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSC CIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAI LEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQR PSRCSNPTPGP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_054728 |
| RefSeq Size | 1869 |
| RefSeq ORF | 1293 |
| Synonyms | AIID; DIETER; IPEX; JM2; PIDX; XPID |
| Locus ID | 50943 |
| Cytogenetics | Xp11.23 |
| Summary | The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402270 | FOXP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426481 | FOXP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402270 | Transient overexpression lysate of forkhead box P3 (FOXP3), transcript variant 1 |
CNY 4840.00 |
|
| LY426481 | Transient overexpression lysate of forkhead box P3 (FOXP3), transcript variant 2 |
CNY 3080.00 |
|
| TP317580 | Recombinant protein of human forkhead box P3 (FOXP3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760693 | Purified recombinant protein of Human forkhead box P3 (FOXP3), transcript variant 2, (10ug), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |


