IFRD1 (NM_001550) Human Mass Spec Standard
CAT#: PH317538
IFRD1 MS Standard C13 and N15-labeled recombinant protein (NP_001541)
View other "IFRD1" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | IFRD1 MS Standard C13 and N15-labeled recombinant protein (NP_001541) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC217538 | 
| Predicted MW | 50.3 kDa | 
| Protein Sequence | 
                 >RC217538 protein sequence 
Red=Cloning site Green=Tags(s) MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEV LDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSD EQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYS TLECLENIFTKSYLKEKDTTVICSTPNTVLHISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDV NMRIAAGESLALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERD FPTETIKFGPERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLKTMKISRF ERHLYNSAAFKARTKARSKCRDKRADVGEFF myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001541 | 
| RefSeq Size | 3305 | 
| RefSeq ORF | 1353 | 
| Synonyms | PC4; TIS7 | 
| Locus ID | 3475 | 
| Cytogenetics | 7q31.1 | 
| Summary | This gene is an immediate early gene that encodes a protein related to interferon-gamma. This protein may function as a transcriptional co-activator/repressor that controls the growth and differentiation of specific cell types during embryonic development and tissue regeneration. Mutations in this gene are associated with sensory/motor neuropathy with ataxia. This gene may also be involved in modulating the pathogenesis of cystic fibrosis lung disease. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2010] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC419866 | IFRD1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC423466 | IFRD1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY419866 | Transient overexpression lysate of interferon-related developmental regulator 1 (IFRD1), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY423466 | Transient overexpression lysate of interferon-related developmental regulator 1 (IFRD1), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| TP317538 | Recombinant protein of human interferon-related developmental regulator 1 (IFRD1), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
