PSMD10 (NM_170750) Human Mass Spec Standard
CAT#: PH317359
PSMD10 MS Standard C13 and N15-labeled recombinant protein (NP_736606)
View other "PSMD10" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | PSMD10 MS Standard C13 and N15-labeled recombinant protein (NP_736606) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217359 |
| Predicted MW | 16 kDa |
| Protein Sequence |
>RC217359 representing NM_170750
Red=Cloning site Green=Tags(s) MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKD DAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEA TAMHRAAAKDT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_736606 |
| RefSeq Size | 1467 |
| RefSeq ORF | 453 |
| Synonyms | dJ889N15.2; p28; p28(GANK) |
| Locus ID | 5716 |
| Cytogenetics | Xq22.3 |
| Summary | This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression of this gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20.[provided by RefSeq, Mar 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406867 | PSMD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419094 | PSMD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406867 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 2 |
CNY 3080.00 |
|
| LY419094 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 1 |
CNY 3080.00 |
|
| PH302025 | PSMD10 MS Standard C13 and N15-labeled recombinant protein (NP_002805) |
CNY 19520.00 |
|
| TP302025 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317359 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP720144 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 1 |
CNY 1800.00 |
