CCBL2 (KYAT3) (NM_001008662) Human Mass Spec Standard
CAT＃: PH317351
CCBL2 MS Standard C13 and N15-labeled recombinant protein (NP_001008662)
View other "CCBL2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | CCBL2 MS Standard C13 and N15-labeled recombinant protein (NP_001008662) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217351 |
| Predicted MW | 47.6 kDa |
| Protein Sequence |
>RC217351 representing NM_001008662
Red=Cloning site Green=Tags(s) MSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHP SLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPV FIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCI SDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCA TPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDL SDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001008662 |
| RefSeq Size | 1938 |
| RefSeq ORF | 1260 |
| Synonyms | CCBL2; KAT3; KATIII |
| Locus ID | 56267 |
| Cytogenetics | 1p22.2 |
| Summary | This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. [provided by RefSeq, Mar 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423344 | CCBL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC423345 | CCBL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY423344 | Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1 |
CNY 4840.00 |
|
| LY423345 | Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2 |
CNY 4840.00 |
|
| PH314155 | CCBL2 MS Standard C13 and N15-labeled recombinant protein (NP_001008661) |
CNY 19520.00 |
|
| TP314155 | Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317351 | Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2, 20 µg |
CNY 2900.00 |
