S6K1 (RPS6KB1) (NM_003161) Human Mass Spec Standard
CAT#: PH317324
RPS6KB1 MS Standard C13 and N15-labeled recombinant protein (NP_003152)
View other "S6K1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RPS6KB1 MS Standard C13 and N15-labeled recombinant protein (NP_003152) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217324 |
| Predicted MW | 59 kDa |
| Protein Sequence |
>RC217324 representing NM_003161
Red=Cloning site Green=Tags(s) MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCE KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHT KAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLH QKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLG ALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHP FFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSG EASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003152 |
| RefSeq Size | 5332 |
| RefSeq ORF | 1575 |
| Synonyms | p70 S6KA; p70(S6K)-alpha; p70-alpha; p70-S6K; PS6K; S6K; S6K-beta-1; S6K1; STK14A |
| Locus ID | 6198 |
| Cytogenetics | 17q23.1 |
| Summary | This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17. [provided by RefSeq, Jan 2013] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Acute myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Insulin signaling pathway, mTOR signaling pathway, TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401097 | RPS6KB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401097 | Transient overexpression lysate of ribosomal protein S6 kinase, 70kDa, polypeptide 1 (RPS6KB1) |
CNY 4840.00 |
|
| TP317324 | Recombinant protein of human ribosomal protein S6 kinase, 70kDa, polypeptide 1 (RPS6KB1), 20 µg |
CNY 2900.00 |


