HIF1 beta (ARNT) (NM_178426) Human Mass Spec Standard
CAT#: PH317284
ARNT MS Standard C13 and N15-labeled recombinant protein (NP_848513)
View other "HIF1 beta" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ARNT MS Standard C13 and N15-labeled recombinant protein (NP_848513) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217284 |
| Predicted MW | 35.8 kDa |
| Protein Sequence |
>RC217284 representing NM_178426
Red=Cloning site Green=Tags(s) MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSND KERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMK SLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLY DQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVN RLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_848513 |
| RefSeq Size | 3563 |
| RefSeq ORF | 984 |
| Synonyms | aryl hydrocarbon receptor nuclear translocator; bHLHe2; dioxin receptor, nuclear translocator; HIF-1beta; HIF1B; HIF1BETA; hypoxia-inducible factor 1, beta subunit; OTTHUMP00000032943; TANGO |
| Locus ID | 405 |
| Cytogenetics | 1q21.3 |
| Summary | This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Pathways in cancer, Renal cell carcinoma |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400636 | ARNT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC405950 | ARNT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400636 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 1 |
CNY 4840.00 |
|
| LY405950 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2 |
CNY 3080.00 |
|
| PH316724 | ARNT MS Standard C13 and N15-labeled recombinant protein (NP_001659) |
CNY 19520.00 |
|
| TP316724 | Recombinant protein of human aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317284 | Purified recombinant protein of Homo sapiens aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2, 20 µg |
CNY 2900.00 |
其它HIF1 beta产品


