C Reactive Protein (CRP) (NM_000567) Human Mass Spec Standard
CAT#: PH317269
CRP MS Standard C13 and N15-labeled recombinant protein (NP_000558)
View other "C Reactive Protein" proteins (1)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
| Cited in 1 publication. |
Specifications
| Product Data | |
| Description | CRP MS Standard C13 and N15-labeled recombinant protein (NP_000558) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217269 |
| Predicted MW | 25 kDa |
| Protein Sequence |
>RC217269 protein sequence
Red=Cloning site Green=Tags(s) MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIF SYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLK KGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKY EVQGEVFTKPQLWP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000558 |
| RefSeq Size | 2024 |
| RefSeq ORF | 672 |
| Synonyms | PTX1 |
| Locus ID | 1401 |
| Cytogenetics | 1q23.2 |
| Summary | The protein encoded by this gene belongs to the pentraxin family which also includes serum amyloid P component protein and pentraxin 3. Pentraxins are involved in complement activation and amplification via communication with complement initiation pattern recognition molecules, but also complement regulation via recruitment of complement regulators. The encoded protein has a calcium dependent ligand binding domain with a distinctive flattened beta-jellyroll structure. It exists in two forms as either a pentamer in circulation or as a nonsoluble monomer in tissues. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. Elevated expression of the encoded protein is associated with severe acute respiratory syndrome coronavirus 2 (SARS‐CoV‐2) infection. [provided by RefSeq, Aug 2020] |
| Protein Families | Secreted Protein |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Modified DNA Aptamers for C-Reactive Protein and Lactate Dehydrogenase-5 with Sub-Nanomolar Affinities
,null,
International Journal of Molecular Sciences
,PubMed ID 32294882
[CRP]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP317269 | Recombinant protein of human C-reactive protein, pentraxin-related (CRP), 20 µg |
CNY 2900.00 |
其它C Reactive Protein产品


