IL32 (NM_001012718) Human Mass Spec Standard
CAT#: PH317258
IL32 MS Standard C13 and N15-labeled recombinant protein (NP_001012736)
View other "IL32" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | IL32 MS Standard C13 and N15-labeled recombinant protein (NP_001012736) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217258 |
| Predicted MW | 21.7 kDa |
| Protein Sequence |
>RC217258 protein sequence
Red=Cloning site Green=Tags(s) MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELT PLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHA VQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001012736 |
| RefSeq Size | 1093 |
| RefSeq ORF | 564 |
| Synonyms | IL-32alpha; IL-32beta; IL-32delta; IL-32gamma; NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd |
| Locus ID | 9235 |
| Cytogenetics | 16p13.3 |
| Summary | This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401352 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422819 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422884 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422885 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422886 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422889 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401352 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 2 |
CNY 3080.00 |
|
| LY422819 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 8 |
CNY 3080.00 |
|
| LY422884 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 1 |
CNY 3080.00 |
|
| LY422885 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 3 |
CNY 3080.00 |
|
| LY422886 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 4 |
CNY 3080.00 |
|
| LY422889 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 7 |
CNY 3080.00 |
|
| PH316048 | IL32 MS Standard C13 and N15-labeled recombinant protein (NP_001012651) |
CNY 19520.00 |
|
| TP316048 | Recombinant protein of human interleukin 32 (IL32), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP317258 | Recombinant protein of human interleukin 32 (IL32), transcript variant 8, 20 µg |
CNY 2900.00 |
|
| TP761648 | Purified recombinant protein of Human interleukin 32 (IL32), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
