AFMID (NM_001010982) Human Mass Spec Standard
CAT#: PH317126
AFMID MS Standard C13 and N15-labeled recombinant protein (NP_001010982)
View other "AFMID" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | AFMID MS Standard C13 and N15-labeled recombinant protein (NP_001010982) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217126 |
| Predicted MW | 33.8 kDa |
| Protein Sequence |
>RC217126 representing NM_001010982
Red=Cloning site Green=Tags(s) MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD GEGEKVDIYFPDESSEALPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQ VTRSVAFVQKRYPSNKGIYLCGHSAGAHLAAMMLLADWTKHGVTPNLRGFFLVSGVFDLEPIVYTSQNVA LQLTLEDAQRNSPQLKVAQAQPVDPTCRVLVVVGQFDSPEFHRQSWEFYQTLCQGEWKASFEELHDVDHF EIVENLTQKDNVLTQIILKTIFQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001010982 |
| RefSeq Size | 1820 |
| RefSeq ORF | 909 |
| Synonyms | FKF; KF; KFA |
| Locus ID | 125061 |
| Cytogenetics | 17q25.3 |
| Summary | Catalyzes the hydrolysis of N-formyl-L-kynurenine to L-kynurenine, the second step in the kynurenine pathway of tryptophan degradation. Kynurenine may be further oxidized to nicotinic acid, NAD(H) and NADP(H). Required for elimination of toxic metabolites.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Tryptophan metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423254 | AFMID HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423254 | Transient overexpression lysate of arylformamidase (AFMID), transcript variant 1 |
CNY 3080.00 |
|
| TP317126 | Recombinant protein of human arylformamidase (AFMID), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760832 | Purified recombinant protein of Human arylformamidase (AFMID), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
