ZNF706 (NM_001042510) Human Mass Spec Standard
CAT#: PH316962
ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035975)
View other "ZNF706" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035975) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216962 |
Predicted MW | 8.5 kDa |
Protein Sequence |
>RC216962 protein sequence
Red=Cloning site Green=Tags(s) MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPE LADVQA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001035975 |
RefSeq Size | 2870 |
RefSeq ORF | 228 |
Synonyms | HSPC038; PNAS-106; PNAS-113 |
Locus ID | 51123 |
Cytogenetics | 8q22.3 |
Summary | Transcription repressor involved in the exit of embryonic stem cells (ESCs) from self-renewal. Acts by repressing expression of KLF4.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414186 | ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420950 | ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420951 | ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414186 | Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 2 |
CNY 3080.00 |
|
LY420950 | Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 1 |
CNY 3080.00 |
|
LY420951 | Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 3 |
CNY 3080.00 |
|
PH309807 | ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_057180) |
CNY 19520.00 |
|
PH320360 | ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035976) |
CNY 19520.00 |
|
TP309807 | Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP316962 | Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP320360 | Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 3, 20 µg |
CNY 2900.00 |