Cytohesin 1 (CYTH1) (NM_004762) Human Mass Spec Standard
CAT#: PH316808
CYTH1 MS Standard C13 and N15-labeled recombinant protein (NP_004753)
View other "Cytohesin 1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CYTH1 MS Standard C13 and N15-labeled recombinant protein (NP_004753) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216808 |
| Predicted MW | 46.4 kDa |
| Protein Sequence |
>RC216808 protein sequence
Red=Cloning site Green=Tags(s) MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGR KKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLN LVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPT VERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKR RWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEG NHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004753 |
| RefSeq Size | 3366 |
| RefSeq ORF | 1194 |
| Synonyms | B2-1; CYTOHESIN-1; D17S811E; PSCD1; SEC7 |
| Locus ID | 9267 |
| Cytogenetics | 17q25.3 |
| Summary | The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This gene is highly expressed in natural killer and peripheral T cells, and regulates the adhesiveness of integrins at the plasma membrane of lymphocytes. A pseudogene of this gene has been defined on the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413760 | CYTH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417775 | CYTH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413760 | Transient overexpression lysate of cytohesin 1 (CYTH1), transcript variant 2 |
CNY 3080.00 |
|
| LY417775 | Transient overexpression lysate of cytohesin 1 (CYTH1), transcript variant 1 |
CNY 3080.00 |
|
| TP316808 | Recombinant protein of human cytohesin 1 (CYTH1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Cytohesin 1产品
