PRCD (NM_001077620) Human Mass Spec Standard

Specifications

Product Data
Description	PRCD MS Standard C13 and N15-labeled recombinant protein (NP_001071088)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC216764
Predicted MW	5.8 kDa
Protein Sequence	Sequence Link (showhide) >RC216764 representing NM_001077620 Red=Cloning site Green=Tags(s) MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_001071088
RefSeq Size	937
RefSeq ORF	162
Synonyms	RP36
Locus ID	768206
Cytogenetics	17q25.1
Summary	This gene is predominantly expressed in the retina, and mutations in this gene are the cause of autosomal recessive retinal degeneration in both humans and dogs. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2010]

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.