HEY1 (NM_001040708) Human Mass Spec Standard
CAT#: PH316696
HEY1 MS Standard C13 and N15-labeled recombinant protein (NP_001035798)
View other "HEY1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HEY1 MS Standard C13 and N15-labeled recombinant protein (NP_001035798) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216696 |
Predicted MW | 32.9 kDa |
Protein Sequence |
>RC216696 representing NM_001040708
Red=Cloning site Green=Tags(s) MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLS ELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVAR YLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGT TASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLYP NALSPSAPTQAANLGKPYRPWGTEIGAF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001035798 |
RefSeq Size | 2331 |
RefSeq ORF | 924 |
Synonyms | BHLHb31; CHF2; HERP2; HESR1; hHRT1; HRT-1; NERP2; OAF1 |
Locus ID | 23462 |
Cytogenetics | 8q21.13 |
Summary | This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400425 | HEY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415875 | HEY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400425 | Transient overexpression lysate of hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 2 |
CNY 3080.00 |
|
LY415875 | Transient overexpression lysate of hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 1 |
CNY 3080.00 |
|
TP316696 | Recombinant protein of human hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP761353 | Purified recombinant protein of Human hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |