BPNT1 (NM_006085) Human Mass Spec Standard
CAT#: PH316622
BPNT1 MS Standard C13 and N15-labeled recombinant protein (NP_006076)
View other "BPNT1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | BPNT1 MS Standard C13 and N15-labeled recombinant protein (NP_006076) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216622 |
| Predicted MW | 33.2 kDa |
| Protein Sequence |
>RC216622 representing NM_006085
Red=Cloning site Green=Tags(s) MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLT IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIA YEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAM NPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMN SAGVLATLRNYDYYASRVPESIKNALVP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006076 |
| RefSeq Size | 2461 |
| RefSeq ORF | 924 |
| Synonyms | HEL20; PIP |
| Locus ID | 10380 |
| Cytogenetics | 1q41 |
| Summary | BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Sulfur metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416871 | BPNT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416871 | Transient overexpression lysate of 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1) |
CNY 3080.00 |
|
| TP316622 | Recombinant protein of human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), 20 µg |
CNY 2900.00 |
