SLAMF8 (NM_020125) Human Mass Spec Standard
CAT#: PH316603
SLAMF8 MS Standard C13 and N15-labeled recombinant protein (NP_064510)
View other "SLAMF8" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SLAMF8 MS Standard C13 and N15-labeled recombinant protein (NP_064510) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216603 |
| Predicted MW | 31.7 kDa |
| Protein Sequence |
>RC216603 protein sequence
Red=Cloning site Green=Tags(s) MVMRPLWSLLLWEALLPITVTGAQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLET LYHSRFLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDA QPSKTCQVFLSCWAPNISEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWD LATVTPWDSCHHEAAPGKASYKDVLLVVVPVSLLLMLVTLFSAWHWCPCSGKKKKDVHADRVGPETENPL VQDLP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_064510 |
| RefSeq Size | 3316 |
| RefSeq ORF | 855 |
| Synonyms | BLAME; CD353; SBBI42 |
| Locus ID | 56833 |
| Cytogenetics | 1q23.2 |
| Summary | This gene encodes a member of the CD2 family of cell surface proteins involved in lymphocyte activation. These proteins are characterized by Ig domains. This protein is expressed in lymphoid tissues, and studies of a similar protein in mouse suggest that it may function during B cell lineage commitment. The gene is found in a region of chromosome 1 containing many CD2 genes. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412665 | SLAMF8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412665 | Transient overexpression lysate of SLAM family member 8 (SLAMF8) |
CNY 3080.00 |
|
| TP316603 | Recombinant protein of human SLAM family member 8 (SLAMF8), 20 µg |
CNY 2900.00 |
