PMP22 (NM_000304) Human Mass Spec Standard
CAT#: PH316500
PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_000295)
View other "PMP22" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_000295) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216500 |
Predicted MW | 17.9 kDa |
Protein Sequence |
>RC216500 protein sequence
Red=Cloning site Green=Tags(s) MLLLLLSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMI LSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYGFAYILAW VAFPLALLSGVIYVILRKRE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000295 |
RefSeq Size | 1861 |
RefSeq ORF | 480 |
Synonyms | CIDP; CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110 |
Locus ID | 5376 |
Cytogenetics | 17p12 |
Summary | This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Studies suggest two alternately used promoters drive tissue-specific expression. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403508 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407108 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424810 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430266 | PMP22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403508 | Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 3 |
CNY 3080.00 |
|
LY407108 | Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 2 |
CNY 3080.00 |
|
LY424810 | Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 1 |
CNY 3080.00 |
|
PH318781 | PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_696997) |
CNY 19520.00 |
|
TP316500 | Recombinant protein of human peripheral myelin protein 22 (PMP22), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP318781 | Recombinant protein of human peripheral myelin protein 22 (PMP22), transcript variant 3, 20 µg |
CNY 2900.00 |