Presenilin 1 (PSEN1) (NM_000021) Human Mass Spec Standard
CAT#: PH316443
PSEN1 MS Standard C13 and N15-labeled recombinant protein (NP_000012)
View other "Presenilin 1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PSEN1 MS Standard C13 and N15-labeled recombinant protein (NP_000012) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216443 |
| Predicted MW | 52.5 kDa |
| Protein Sequence |
>RC216443 representing NM_000021
Red=Cloning site Green=Tags(s) MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEED EELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMI SVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGM ISIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNE TLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGP HRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCL TLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000012 |
| RefSeq Size | 2763 |
| RefSeq ORF | 1401 |
| Synonyms | ACNINV3; AD3; FAD; PS-1; PS1; S182 |
| Locus ID | 5663 |
| Cytogenetics | 14q24.2 |
| Summary | Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or in the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor, such that they either directly regulate gamma-secretase activity or themselves are protease enzymes. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene, the full-length nature of only some have been determined. [provided by RefSeq, Aug 2008] |
| Protein Families | Druggable Genome, Protease, Transmembrane |
| Protein Pathways | Alzheimer's disease, Neurotrophin signaling pathway, Notch signaling pathway, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424973 | PSEN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424973 | Transient overexpression lysate of presenilin 1 (PSEN1), transcript variant 1 |
CNY 3080.00 |
|
| TP316443 | Recombinant protein of human presenilin 1 (PSEN1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Presenilin 1产品
