RAD1 (NM_002853) Human Mass Spec Standard
CAT#: PH316420
RAD1 MS Standard C13 and N15-labeled recombinant protein (NP_002844)
View other "RAD1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RAD1 MS Standard C13 and N15-labeled recombinant protein (NP_002844) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216420 |
Predicted MW | 31.8 kDa |
Protein Sequence |
>RC216420 protein sequence
Red=Cloning site Green=Tags(s) MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIF QEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLMLFLEEGGVVTVCKINTQEPE ETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLM EAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES ES myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002844 |
RefSeq Size | 4683 |
RefSeq ORF | 846 |
Synonyms | HRAD1; REC1 |
Locus ID | 5810 |
Cytogenetics | 5p13.2 |
Summary | This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403338 | RAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419081 | RAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403338 | Transient overexpression lysate of RAD1 homolog (S. pombe) (RAD1), transcript variant 3 |
CNY 3080.00 |
|
LY419081 | Transient overexpression lysate of RAD1 homolog (S. pombe) (RAD1), transcript variant 1 |
CNY 3080.00 |
|
TP316420 | Recombinant protein of human RAD1 homolog (S. pombe) (RAD1), transcript variant 1, 20 µg |
CNY 2900.00 |