p21 Ras (HRAS) (NM_005343) Human Mass Spec Standard
CAT#: PH316409
HRAS MS Standard C13 and N15-labeled recombinant protein (NP_005334)
View other "p21 Ras" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | HRAS MS Standard C13 and N15-labeled recombinant protein (NP_005334) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216409 |
Predicted MW | 21.1 kDa |
Protein Sequence |
>RC216409 representing NM_005343
Red=Cloning site Green=Tags(s) MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ YMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLVRSYGIP YIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005334 |
RefSeq Size | 1061 |
RefSeq ORF | 567 |
Synonyms | C-BAS/HAS; C-H-RAS; C-HA-RAS1; CTLO; H-RASIDX; HAMSV; HRAS1; p21ras; RASH1 |
Locus ID | 3265 |
Cytogenetics | 11p15.5 |
Summary | This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, cognitive disability, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Acute myeloid leukemia, Axon guidance, B cell receptor signaling pathway, Bladder cancer, Chemokine signaling pathway, Chronic myeloid leukemia, Endocytosis, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Focal adhesion, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term depression, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Melanoma, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Thyroid cancer, Tight junction, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401645 | HRAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406123 | HRAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427210 | HRAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430451 | HRAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401645 | Transient overexpression lysate of v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 1 |
CNY 3080.00 |
|
LY406123 | Transient overexpression lysate of v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 2 |
CNY 3080.00 |
|
LY427210 | Transient overexpression lysate of v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 3 |
CNY 3080.00 |
|
PH325202 | HRAS MS Standard C13 and N15-labeled recombinant protein (NP_001123914) |
CNY 19520.00 |
|
TP316409 | Recombinant protein of human v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP325202 | Recombinant protein of human v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 3, 20 µg |
CNY 2900.00 |
其它p21 Ras产品