TAGLN3 (NM_001008273) Human Mass Spec Standard
CAT#: PH316395
TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008274)
View other "TAGLN3" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008274) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216395 |
| Predicted MW | 22.5 kDa |
| Protein Sequence |
>RC216395 protein sequence
Red=Cloning site Green=Tags(s) MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLY PPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKD DGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001008274 |
| RefSeq Size | 1214 |
| RefSeq ORF | 597 |
| Synonyms | NP22; NP24; NP25 |
| Locus ID | 29114 |
| Cytogenetics | 3q13.2 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415704 | TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423411 | TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423412 | TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415704 | Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 1 |
CNY 3080.00 |
|
| LY423411 | Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 2 |
CNY 3080.00 |
|
| LY423412 | Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 3 |
CNY 3080.00 |
|
| PH304424 | TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_037391) |
CNY 19520.00 |
|
| PH323474 | TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008273) |
CNY 19520.00 |
|
| TP304424 | Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP316395 | Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP323474 | Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 2, 20 µg |
CNY 2900.00 |
