RAB6B (NM_016577) Human Mass Spec Standard
CAT#: PH316303
RAB6B MS Standard C13 and N15-labeled recombinant protein (NP_057661)
View other "RAB6B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAB6B MS Standard C13 and N15-labeled recombinant protein (NP_057661) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216303 |
| Predicted MW | 23.3 kDa |
| Protein Sequence |
>RC216303 representing NM_016577
Red=Cloning site Green=Tags(s) MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA GQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE GEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057661 |
| RefSeq Size | 5561 |
| RefSeq ORF | 624 |
| Locus ID | 51560 |
| Cytogenetics | 3q22.1 |
| Summary | Seems to have a role in retrograde membrane traffic at the level of the Golgi complex. May function in retrograde transport in neuronal cells.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413899 | RAB6B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413899 | Transient overexpression lysate of RAB6B, member RAS oncogene family (RAB6B) |
CNY 3080.00 |
|
| TP316303 | Recombinant protein of human RAB6B, member RAS oncogene family (RAB6B), 20 µg |
CNY 2900.00 |
