NY-ESO-1 (CTAG1A) (NM_139250) Human Mass Spec Standard
CAT#: PH316285
CTAG1A MS Standard C13 and N15-labeled recombinant protein (NP_640343)
View other "NY-ESO-1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CTAG1A MS Standard C13 and N15-labeled recombinant protein (NP_640343) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216285 |
| Predicted MW | 18 kDa |
| Protein Sequence |
>RC216285 protein sequence
Red=Cloning site Green=Tags(s) MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_640343 |
| RefSeq Size | 748 |
| RefSeq ORF | 540 |
| Synonyms | CT6.1; ESO1; LAGE-2; LAGE2A; NY-ESO-1 |
| Locus ID | 246100 |
| Cytogenetics | Xq28 |
| Summary | The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. [provided by RefSeq, Dec 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408315 | CTAG1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408315 | Transient overexpression lysate of cancer/testis antigen 1A (CTAG1A) |
CNY 3080.00 |
|
| TP316285 | Recombinant protein of human cancer/testis antigen 1A (CTAG1A), 20 µg |
CNY 2900.00 |
其它NY-ESO-1产品
