BRN3A (POU4F1) (NM_006237) Human Mass Spec Standard
CAT#: PH316284
POU4F1 MS Standard C13 and N15-labeled recombinant protein (NP_006228)
View other "BRN3A" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | POU4F1 MS Standard C13 and N15-labeled recombinant protein (NP_006228) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216284 |
| Predicted MW | 42.5 kDa |
| Protein Sequence |
>RC216284 representing NM_006237
Red=Cloning site Green=Tags(s) MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQ GKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGG GGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNM PSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRI KLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELF NGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006228 |
| RefSeq Size | 3824 |
| RefSeq ORF | 1257 |
| Synonyms | ATITHS; brn-3A; BRN3A; Oct-T1; RDC-1 |
| Locus ID | 5457 |
| Cytogenetics | 13q31.1 |
| Summary | This gene encodes a member of the POU-IV class of neural transcription factors. This protein is expressed in a subset of retinal ganglion cells and may be involved in the developing sensory nervous system. This protein may also promote the growth of cervical tumors. A translocation of this gene is associated with some adult acute myeloid leukemias. [provided by RefSeq, Mar 2012] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416781 | POU4F1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY416781 | Transient overexpression lysate of POU class 4 homeobox 1 (POU4F1) |
CNY 4840.00 |
|
| TP316284 | Recombinant protein of human POU class 4 homeobox 1 (POU4F1), 20 µg |
CNY 2900.00 |
|
| TP762410 | Purified recombinant protein of Human Mass Spec Standard(BRN3A), with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
