DUSP15 (NM_177991) Human Mass Spec Standard
CAT#: PH316271
DUSP15 MS Standard C13 and N15-labeled recombinant protein (NP_817130)
View other "DUSP15" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | DUSP15 MS Standard C13 and N15-labeled recombinant protein (NP_817130) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216271 |
| Predicted MW | 14.5 kDa |
| Protein Sequence |
>RC216271 representing NM_177991
Red=Cloning site Green=Tags(s) MTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKLRRQLEERFGESPFRDEEELRALLPLCK RCRQGSATSASSAGPHSAASEGTVQRLVPRTPREAHRPLPLLARVKQTFSCLPRCLSRKGGK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_817130 |
| RefSeq Size | 1184 |
| RefSeq ORF | 396 |
| Synonyms | C20orf57; VHY |
| Locus ID | 128853 |
| Cytogenetics | 20q11.21 |
| Summary | The protein encoded by this gene has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. This protein may function in the differentiation of oligodendrocytes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405882 | DUSP15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409154 | DUSP15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405882 | Transient overexpression lysate of dual specificity phosphatase 15 (DUSP15), transcript variant 2 |
CNY 3080.00 |
|
| LY409154 | Transient overexpression lysate of dual specificity phosphatase 15 (DUSP15), transcript variant 1 |
CNY 3080.00 |
|
| TP316271 | Recombinant protein of human dual specificity phosphatase 15 (DUSP15), transcript variant 2, 20 µg |
CNY 2900.00 |
