PRX (NM_020956) Human Mass Spec Standard
CAT#: PH316161
PRX MS Standard C13 and N15-labeled recombinant protein (NP_066007)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PRX MS Standard C13 and N15-labeled recombinant protein (NP_066007) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216161 |
| Predicted MW | 15.8 kDa |
| Protein Sequence |
>RC216161 protein sequence
Red=Cloning site Green=Tags(s) MEARSRSAEELRRAELVEIIVETEAQTGVSGINVAGGGKEGIFVRELREDSPAARSLSLQEGDQLLSARV FFENFKYEDALRLLQCAEPYKVSFCLKRTVPTGDLALRPGTVSGYEIKGPRAKVAKLVRVLSPAPALDCP SDPVSAP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_066007 |
| RefSeq Size | 5502 |
| RefSeq ORF | 441 |
| Synonyms | CMT4F |
| Locus ID | 57716 |
| Cytogenetics | 19q13.2 |
| Summary | This gene encodes a protein involved in peripheral nerve myelin upkeep. The encoded protein contains 2 PDZ domains which were named after PSD95 (post synaptic density protein), DlgA (Drosophila disc large tumor suppressor), and ZO1 (a mammalian tight junction protein). Two alternatively spliced transcript variants have been described for this gene which encode different protein isoforms and which are targeted differently in the Schwann cell. Mutations in this gene cause Charcot-Marie-Tooth neuoropathy, type 4F and Dejerine-Sottas neuropathy. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412179 | PRX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412179 | Transient overexpression lysate of periaxin (PRX), transcript variant 1 |
CNY 3080.00 |
|
| TP316161 | Recombinant protein of human periaxin (PRX), transcript variant 1, 20 µg |
CNY 2900.00 |
