NCF4 (NM_000631) Human Mass Spec Standard
CAT#: PH316094
NCF4 MS Standard C13 and N15-labeled recombinant protein (NP_000622)
View other "NCF4" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | NCF4 MS Standard C13 and N15-labeled recombinant protein (NP_000622) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216094 |
| Predicted MW | 38.9 kDa |
| Protein Sequence |
>RC216094 representing NM_000631
Red=Cloning site Green=Tags(s) MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLE ERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDS EQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEG TVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQR EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000622 |
| RefSeq Size | 1386 |
| RefSeq ORF | 1017 |
| Synonyms | CGD3; NCF; P40PHOX; SH3PXD4 |
| Locus ID | 4689 |
| Cytogenetics | 22q12.3 |
| Summary | The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Leukocyte transendothelial migration |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402260 | NCF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424600 | NCF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402260 | Transient overexpression lysate of neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2 |
CNY 3080.00 |
|
| LY424600 | Transient overexpression lysate of neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1 |
CNY 3080.00 |
|
| TP316094 | Recombinant protein of human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760264 | Recombinant protein of human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
| TP760667 | Purified recombinant protein of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
