CTNNBIP1 (NM_020248) Human Mass Spec Standard
CAT＃: PH316082
CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_064633)
View other "CTNNBIP1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_064633) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216082 |
| Predicted MW | 9 kDa |
| Protein Sequence |
>RC216082 representing NM_020248
Red=Cloning site Green=Tags(s) MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA FSRSETEDRRQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_064633 |
| RefSeq Size | 2995 |
| RefSeq ORF | 243 |
| Synonyms | ICAT |
| Locus ID | 56998 |
| Cytogenetics | 1p36.22 |
| Summary | The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412546 | CTNNBIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423325 | CTNNBIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412546 | Transient overexpression lysate of catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1 |
CNY 3080.00 |
|
| LY423325 | Transient overexpression lysate of catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 2 |
CNY 3080.00 |
|
| PH312922 | CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001012329) |
CNY 19520.00 |
|
| TP312922 | Recombinant protein of human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP316082 | Recombinant protein of human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它CTNNBIP1产品
