Luteinizing Hormone beta (LHB) (NM_000894) Human Mass Spec Standard
CAT#: PH316028
LHB MS Standard C13 and N15-labeled recombinant protein (NP_000885)
View other "Luteinizing Hormone beta" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LHB MS Standard C13 and N15-labeled recombinant protein (NP_000885) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216028 |
| Predicted MW | 15.35 kDa |
| Protein Sequence |
>RC216028 representing NM_000894
Red=Cloning site Green=Tags(s) MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLP PLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLF L myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000885 |
| RefSeq Size | 523 |
| RefSeq ORF | 423 |
| Synonyms | CGB4; HH23; LSH-B; LSH-beta |
| Locus ID | 3972 |
| Cytogenetics | 19q13.33 |
| Summary | This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | GnRH signaling pathway, Neuroactive ligand-receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424466 | LHB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424466 | Transient overexpression lysate of luteinizing hormone beta polypeptide (LHB) |
CNY 3080.00 |
|
| TP316028 | Recombinant protein of human luteinizing hormone beta polypeptide (LHB), 20 µg |
CNY 2900.00 |
其它Luteinizing Hormone beta产品
