H2BC1 (NM_170610) Human Mass Spec Standard
CAT#: PH315946
HIST1H2BA MS Standard C13 and N15-labeled recombinant protein (NP_733759)
View other "H2BC1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | HIST1H2BA MS Standard C13 and N15-labeled recombinant protein (NP_733759) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215946 |
Predicted MW | 14.2 kDa |
Protein Sequence |
>RC215946 protein sequence
Red=Cloning site Green=Tags(s) MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTD IFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_733759 |
RefSeq Size | 437 |
RefSeq ORF | 381 |
Synonyms | bA317E16.3; H2BFU; HIST1H2BA; hTSH2B; STBP; TH2B; TSH2B; TSH2B.1 |
Locus ID | 255626 |
Cytogenetics | 6p22.2 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq, Aug 2015] |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406917 | HIST1H2BA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406917 | Transient overexpression lysate of histone cluster 1, H2ba (HIST1H2BA) |
CNY 3080.00 |
|
TP315946 | Recombinant protein of human histone cluster 1, H2ba (HIST1H2BA), 20 µg |
CNY 2900.00 |