H2BC1 (NM_170610) Human Mass Spec Standard
CAT#: PH315946
HIST1H2BA MS Standard C13 and N15-labeled recombinant protein (NP_733759)
View other "H2BC1" proteins (3)
| Need it in bulk or customized? Get a free quote | 
CNY 19520.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | HIST1H2BA MS Standard C13 and N15-labeled recombinant protein (NP_733759) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC215946 | 
| Predicted MW | 14.2 kDa | 
| Protein Sequence | >RC215946 protein sequence Red=Cloning site Green=Tags(s) MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTD IFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_733759 | 
| RefSeq Size | 437 | 
| RefSeq ORF | 381 | 
| Synonyms | bA317E16.3; H2BFU; HIST1H2BA; hTSH2B; STBP; TH2B; TSH2B; TSH2B.1 | 
| Locus ID | 255626 | 
| Cytogenetics | 6p22.2 | 
| Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq, Aug 2015] | 
| Protein Pathways | Systemic lupus erythematosus | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC406917 | HIST1H2BA HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY406917 | Transient overexpression lysate of histone cluster 1, H2ba (HIST1H2BA) | CNY 3080.00 | |
| TP315946 | Recombinant protein of human histone cluster 1, H2ba (HIST1H2BA), 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 

 
                        


 
        