CARD9 (NM_052813) Human Mass Spec Standard
CAT＃: PH315899
CARD9 MS Standard C13 and N15-labeled recombinant protein (NP_434700)
View other "CARD9" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 4840.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CARD9 MS Standard C13 and N15-labeled recombinant protein (NP_434700) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215899 |
| Predicted MW | 62.1 kDa |
| Protein Sequence |
>RC215899 representing NM_052813
Red=Cloning site Green=Tags(s) MSDYENDDECWNVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQR TGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSK DDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEI DQLKHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYI QVLEEDWRQALRDHQEQANTIFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQM EEVAIERDQAIATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDAGLSSGEPPEK ERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS TRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_434700 |
| RefSeq Size | 2136 |
| RefSeq ORF | 1608 |
| Synonyms | CANDF2; hCARD9 |
| Locus ID | 64170 |
| Cytogenetics | 9q34.3 |
| Summary | The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | NOD-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409473 | CARD9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC429892 | CARD9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409473 | Transient overexpression lysate of caspase recruitment domain family, member 9 (CARD9), transcript variant 1 |
CNY 4840.00 |
|
| LY429892 | Transient overexpression lysate of caspase recruitment domain family, member 9 (CARD9), transcript variant 2 |
CNY 3080.00 |
|
| PH325844 | CARD9 MS Standard C13 and N15-labeled recombinant protein (NP_434701) |
CNY 19520.00 |
|
| TP315899 | Recombinant protein of human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325844 | Recombinant protein of human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, 20 µg |
CNY 2900.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
