QK1 (QKI) (NM_206854) Human Mass Spec Standard
CAT#: PH315734
QKI MS Standard C13 and N15-labeled recombinant protein (NP_996736)
View other "QK1" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | QKI MS Standard C13 and N15-labeled recombinant protein (NP_996736) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215734 |
| Predicted MW | 35.8 kDa |
| Protein Sequence |
>RC215734 representing NM_206854
Red=Cloning site Green=Tags(s) MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSA ELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRG KPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIK SPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPE AGLIYTPYEYPYTLAPATSILEYPIEPSGVLEWIEMPVMPDISAH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_996736 |
| RefSeq Size | 6972 |
| RefSeq ORF | 975 |
| Synonyms | Hqk; hqkI; QK; QK1; QK3 |
| Locus ID | 9444 |
| Cytogenetics | 6q26 |
| Summary | The protein encoded by this gene is an RNA-binding protein that regulates pre-mRNA splicing, export of mRNAs from the nucleus, protein translation, and mRNA stability. The encoded protein is involved in myelinization and oligodendrocyte differentiation and may play a role in schizophrenia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402025 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403718 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403730 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403731 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402025 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 1 |
CNY 3080.00 |
|
| LY403718 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 4 |
CNY 3080.00 |
|
| LY403730 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 2 |
CNY 3080.00 |
|
| LY403731 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 3 |
CNY 3080.00 |
|
| PH305779 | QKI MS Standard C13 and N15-labeled recombinant protein (NP_006766) |
CNY 19520.00 |
|
| PH315788 | QKI MS Standard C13 and N15-labeled recombinant protein (NP_996737) |
CNY 19520.00 |
|
| PH324090 | QKI MS Standard C13 and N15-labeled recombinant protein (NP_996735) |
CNY 19520.00 |
|
| TP305779 | Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP315734 | Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP315788 | Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP324090 | Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 2, 20 µg |
CNY 2900.00 |


