EBAG9 (NM_198120) Human Mass Spec Standard
CAT＃: PH315667
EBAG9 MS Standard C13 and N15-labeled recombinant protein (NP_936056)
View other "EBAG9" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | EBAG9 MS Standard C13 and N15-labeled recombinant protein (NP_936056) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215667 |
| Predicted MW | 24.4 kDa |
| Protein Sequence |
>RC215667 protein sequence
Red=Cloning site Green=Tags(s) MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTS VKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFI HQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGV KLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_936056 |
| RefSeq Size | 2328 |
| RefSeq ORF | 639 |
| Synonyms | EB9; PDAF |
| Locus ID | 9166 |
| Cytogenetics | 8q23.2 |
| Summary | This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405069 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418143 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430709 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405069 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2 |
CNY 3080.00 |
|
| LY418143 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 1 |
CNY 3080.00 |
|
| LY430709 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2 |
CNY 3080.00 |
|
| PH305364 | EBAG9 MS Standard C13 and N15-labeled recombinant protein (NP_004206) |
CNY 19520.00 |
|
| TP305364 | Recombinant protein of human estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP315667 | Recombinant protein of human estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2, 20 µg |
CNY 2900.00 |
