ADRM1 (NM_007002) Human Mass Spec Standard
CAT#: PH315635
ADRM1 MS Standard C13 and N15-labeled recombinant protein (NP_008933)
View other "ADRM1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ADRM1 MS Standard C13 and N15-labeled recombinant protein (NP_008933) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215635 |
| Predicted MW | 42.15 kDa |
| Protein Sequence |
>RC215635 representing NM_007002
Red=Cloning site Green=Tags(s) MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVE DDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGAS GSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSR SQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGP AGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASG QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008933 |
| RefSeq Size | 1410 |
| RefSeq ORF | 1221 |
| Synonyms | ARM-1; ARM1; GP110; PSMD16 |
| Locus ID | 11047 |
| Cytogenetics | 20q13.33 |
| Summary | This gene encodes a member of the adhesion regulating molecule 1 protein family. The encoded protein is a component of the proteasome where it acts as a ubiquitin receptor and recruits the deubiquitinating enzyme, ubiquitin carboxyl-terminal hydrolase L5. Increased levels of the encoded protein are associated with increased cell adhesion, which is likely an indirect effect of this intracellular protein. Dysregulation of this gene has been implicated in carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402072 | ADRM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406279 | ADRM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402072 | Transient overexpression lysate of adhesion regulating molecule 1 (ADRM1), transcript variant 1 |
CNY 3080.00 |
|
| LY406279 | Transient overexpression lysate of adhesion regulating molecule 1 (ADRM1), transcript variant 2 |
CNY 3080.00 |
|
| PH305671 | ADRM1 MS Standard C13 and N15-labeled recombinant protein (NP_783163) |
CNY 19520.00 |
|
| TP305671 | Recombinant protein of human adhesion regulating molecule 1 (ADRM1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP315635 | Recombinant protein of human adhesion regulating molecule 1 (ADRM1), transcript variant 1, 20 µg |
CNY 2900.00 |
