EDA (NM_001005610) Human Mass Spec Standard
CAT#: PH315628
EDA MS Standard C13 and N15-labeled recombinant protein (NP_001005610)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | EDA MS Standard C13 and N15-labeled recombinant protein (NP_001005610) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215628 |
| Predicted MW | 19 kDa |
| Protein Sequence |
>RC215628 representing NM_001005610
Red=Cloning site Green=Tags(s) MGYPEVERRELLPAAAPRERGSQGCGCGGAPARAGEGNSCLLFLGFFGLSLALHLLTLCCYLELRSELRR ERGAESRLGGSGTPGTSGTLSSLGGLDPDSPITSHLGQPSPKQQPLEPGEAALHSDSQDGHQMALLNFFF PDEKPYSEEESRRVRRNKRSKSNEGADGKSTQLILYHF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001005610 |
| RefSeq Size | 1089 |
| RefSeq ORF | 534 |
| Synonyms | ECTD1; ED1; ED1-A1; ED1-A2; EDA-A1; EDA-A2; EDA1; EDA2; HED; HED1; ODT1; STHAGX1; TNLG7C; XHED; XLHED |
| Locus ID | 1896 |
| Cytogenetics | Xq13.1 |
| Summary | The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423629 | EDA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423629 | Transient overexpression lysate of ectodysplasin A (EDA), transcript variant 3 |
CNY 3080.00 |
|
| TP315628 | Recombinant protein of human ectodysplasin A (EDA), transcript variant 3, 20 µg |
CNY 2900.00 |
