TATDN3 (NM_001042553) Human Mass Spec Standard
CAT＃: PH315613
TATDN3 MS Standard C13 and N15-labeled recombinant protein (NP_001036018)
View other "TATDN3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | TATDN3 MS Standard C13 and N15-labeled recombinant protein (NP_001036018) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215613 |
| Predicted MW | 30.3 kDa |
| Protein Sequence |
>RC215613 protein sequence
Red=Cloning site Green=Tags(s) MRAAGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCLGVH PVQGLPPEDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQRQVLIRQIQLAKRL NLPVNVHSRSAGRPTINLLQEQGAEKVLLHAFDGRPSVAMEGVRAGYFFSIPPSIIRSGQKQKLVKQLPL TSICLETDSPALGPEKQVRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFPKLRHLLQK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001036018 |
| RefSeq Size | 2585 |
| RefSeq ORF | 822 |
| Locus ID | 128387 |
| Cytogenetics | 1q32.3 |
| Summary | Putative deoxyribonuclease.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420981 | TATDN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420982 | TATDN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431198 | TATDN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420981 | Transient overexpression lysate of TatD DNase domain containing 3 (TATDN3), transcript variant 1 |
CNY 3080.00 |
|
| LY420982 | Transient overexpression lysate of TatD DNase domain containing 3 (TATDN3), transcript variant 2 |
CNY 3080.00 |
|
| LY431198 | Transient overexpression lysate of TatD DNase domain containing 3 (TATDN3), transcript variant 3 |
CNY 3080.00 |
|
| TP315613 | Recombinant protein of human TatD DNase domain containing 3 (TATDN3), transcript variant 2, 20 µg |
CNY 2900.00 |
