Glutaredoxin 2 (GLRX2) (NM_016066) Human Mass Spec Standard
CAT#: PH315566
GLRX2 MS Standard C13 and N15-labeled recombinant protein (NP_057150)
View other "Glutaredoxin 2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | GLRX2 MS Standard C13 and N15-labeled recombinant protein (NP_057150) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215566 |
Predicted MW | 18.5 kDa |
Protein Sequence |
>RC215566 representing NM_016066
Red=Cloning site Green=Tags(s) MNPRDKQVSRFSPLKDVYTWVALAGIQRSGSPGRTRSAARRMESNTSSSLENLATAPVNQIQETISDNCV VIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHR LHKEGKLLPLVHQCYLKKSKRKEFQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057150 |
RefSeq Size | 1170 |
RefSeq ORF | 495 |
Synonyms | CGI-133; GRX2 |
Locus ID | 51022 |
Cytogenetics | 1q31.2 |
Summary | The protein encoded by this gene is a member of the glutaredoxin family of proteins, which maintain cellular thiol homeostasis. These proteins are thiol-disulfide oxidoreductases that use a glutathione-binding site and one or two active cysteines in their active site. This gene undergoes alternative splicing to produce multiple isoforms, one of which is ubiquitously expressed and localizes to mitochondria, where it functions in mitochondrial redox homeostasis and is important for the protection against and recovery from oxidative stress. Other isoforms, which have more restrictive expression patterns, show cytosolic and nuclear localization, and are thought to function in cellular differentiation and transformation, possibly with a role in tumor progression. [provided by RefSeq, Aug 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414214 | GLRX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414214 | Transient overexpression lysate of glutaredoxin 2 (GLRX2), transcript variant 1 |
CNY 3080.00 |
|
TP315566 | Recombinant protein of human glutaredoxin 2 (GLRX2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Glutaredoxin 2产品