RYK (NM_001005861) Human Mass Spec Standard
CAT#: PH315449
RYK MS Standard C13 and N15-labeled recombinant protein (NP_001005861)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
Specifications
Product Data | |
Description | RYK MS Standard C13 and N15-labeled recombinant protein (NP_001005861) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215449 |
Predicted MW | 67.9 kDa |
Protein Sequence |
>RC215449 representing NM_001005861
Red=Cloning site Green=Tags(s) MRGAARLGRPGRSCLPGARGLRAPPPPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASAGPSVSLYLSE DEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNI SVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNT SRTIYDPVHAAPTTSTRVFYISVGVCCAVIFLVAIILAVLHLHSMKRIELDDSISASSSSQGLSQPSTQT TQYLRADTPNNATPITSSLGYPTLRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHG ILIDEKDPNKEKQAFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEKPMVILPYMNWG NLKLFLRQCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALS RDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPFEMAAYLKD GYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALGAYV SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001005861 |
RefSeq Size | 2960 |
RefSeq ORF | 1830 |
Synonyms | D3S3195; JTK5; JTK5A; RYK1 |
Locus ID | 6259 |
Cytogenetics | 3q22.2 |
Summary | The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. The encoded protein has a leucine-rich extracellular domain with a WIF-type Wnt binding region, a single transmembrane domain, and an intracellular tyrosine kinase domain. This protein is involved in stimulating Wnt signaling pathways such as the regulation of axon pathfinding. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418988 | RYK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC423665 | RYK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC425156 | RYK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418988 | Transient overexpression lysate of RYK receptor-like tyrosine kinase (RYK), transcript variant 2 |
CNY 4840.00 |
|
LY423665 | Transient overexpression lysate of RYK receptor-like tyrosine kinase (RYK), transcript variant 1 |
CNY 4840.00 |
|
PH315509 | RYK MS Standard C13 and N15-labeled recombinant protein (NP_002949) |
CNY 19520.00 |
|
TP315449 | Recombinant protein of human RYK receptor-like tyrosine kinase (RYK), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP315509 | Recombinant protein of human RYK receptor-like tyrosine kinase (RYK), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP700167 | Purified recombinant protein of human receptor-like tyrosine kinase (RYK), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6650.00 |