SPRR2A (NM_005988) Human Mass Spec Standard
CAT#: PH315197
SPRR2A MS Standard C13 and N15-labeled recombinant protein (NP_005979)
View other "SPRR2A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | SPRR2A MS Standard C13 and N15-labeled recombinant protein (NP_005979) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215197 |
Predicted MW | 8 kDa |
Protein Sequence |
>RC215197 protein sequence
Red=Cloning site Green=Tags(s) MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPK SK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005979 |
RefSeq Size | 692 |
RefSeq ORF | 216 |
Locus ID | 6700 |
Cytogenetics | 1q21.3 |
Summary | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416935 | SPRR2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416935 | Transient overexpression lysate of small proline-rich protein 2A (SPRR2A) |
CNY 3080.00 |
|
TP315197 | Recombinant protein of human small proline-rich protein 2A (SPRR2A), 20 µg |
CNY 2900.00 |